TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q7A3S4|Q7A3S4_STAAN SA2203 protein OS=Staphylococcus aureus (strain N315) GN=SA2203 PE=4 SV=1
MSKKQKLTMIITMLMGGFFGLLNETLLVTALPSIMKDFEISYTQVQWLTTAFLLTNGIVIPLSALVIQRYTTRQVFLVGI
SIFFLGTLLGGLSPHFATLLVARIIQALGAGIMMPLMMTTILDVFQPHERGKYMGIFGLVIGLAPAIGPTLSGYLVEYLN
WRSLFHVVAPIAAVTFLIGFKTIKNVGTTIKVPIDFISVIFSVLGFGGLLYGTSSISEKGFDNPIVLVSMIGGVVLVALF
VLRQYRLSTPLLNFAVFKNKQFTVGIIIMGVTMVSMIGSETILPIFVQNLLHRSALDSGLTLLPGAIVMAFMSMTSGALY
EKFGPRKLALVGMAIVVITTAYFVVMDEQTSTIMLATVYAIRMVGIALGLIPVMTHTMNQLKPEMNAHGSSMTNTVQQIA
GSIGTAALITILSHASKNFSPTMSDYNGMNKIDMMNQIKVDTMLHGYHAGFLFALLITVVSFFCSFMLQGKKKEVDSRQ