TCDB is operated by the Saier Lab Bioinformatics Group
>Q7D911|Q7D911_MYCTU Putative uncharacterized protein - Mycobacterium tuberculosis.
MNDQAPVAYAPLWRTAWRRLRQRPFQYILLVLGIALGVAMIVAIDVSSNSAQRAFDLSAAAITGKSTHRLVSGPAGVDQQ
LYFDLRRHGYDFSAPVIEGYVLARGLGNRAMQFMGTDPFAESAFRSPLWSNQNIAELGGFLTRPNGVVLSRQVAQKYGLA
VGDRIALQVKGAPTTVTLVGLLTPADEVSNQKLSDLIIADISTAQELFHMPGRLSHIDLIIKDEATATRIQQRLPAGVRM
ETSDTQRDTVKQMTDAFTVNLTALSLIALLVGIFLIYNTVTFNVVQRRPFFAILRCLGVTREQLFWLIMTESLVAGLIGT
GLGLLIGIWLGEGLIGLVTQTINDFYFVINVRNVSVSAESLLKGLIIGIFAAMLATLPPAIEAMRTVPASTLRRSSLESK
ITKLMPWLWVAWFGLGSFGVLMLWLPGNNLVVAFVGLFSVLIALALIAPPLTRFVMLRLAPGLGRLLGPIGRMAPRNIVR
SLSRTSIAIAALMMAVSLMVGVSISVGSFRQTLANWLEVTLKSDVYVSPPTLTSGRPSGNLPVDAVRNISKWPGVRDAVM
ARYSSVFAPDWGREVELMAVSGDISDGKRPYRWIDGNKDTLWPRFLAGKGVMLSEPMVSRQHLQMPPRPITLMTDSGPQT
FPVLAVFSDYTSDQGVILMDRASYRAHWQDDDVTTMFLFLASGANSGALIDQLQAAFAGREDIVIQSTHSVREASMFIFD
RSFTITIALQLVATVVAFIGVLSALMSLELDRAHELGVFRAIGMTTRQLWKLMFIETGLMGGMAGLMALPTGCILAWILV
RIINVRSFGWTLQMHFESAHFLRALLVAVVAALAAGMYPAWRLGRMTIRTAIREE