TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q7MVK6|Q7MVK6_PORGI Uncharacterized protein OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=PG_1051 PE=4 SV=1
MSETFSVRFVRLLRQNMNVVFLILGIVVLSLLYPLVKDWQVFDPKKAMPPFFVWIFVIVMGGMTVATGVRTVFLTDSTIF
RKLLVISFVVAAVGQLLGFAIGAIWLFCGISYVYAIAQKKFYLPVGILVLLVAYYLFQMTGLIGAVETKDALHTLKQRLP
LLALPLALCCWRPTRTEWGVFLSFSFRLVLVYLSCIIVVSLLLNQYYGQSILSPFSFDKFYLKTHIPTLASSFCMLHWTH
FAHPTYIFLGIFAIFMAVAVRQYFYREQTVSTVEMIYGLVALSCFAFITQSRLAMLFIPLSIMFFFLVRAFFLSQKKKLL
FTSFMLIIVGGFIFNGLLSHRFFADGERMQMRDIAMDAINRHPWTGIRLGTMDNILQAQIDTDILLKHPHNQLLADGMQL
GIPGMVVLVVFVGGLFYFAYRDRRYDFLLFLPAILLTMAVESPLIFVRGAYLLAFWFSVFAVSPTRKKDFA