TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q7SXB7|MFD4A_DANRE Major facilitator superfamily domain-containing protein 4-A OS=Danio rerio GN=mfsd4a PE=2 SV=1
MTYLLNERICALFRSNWQHTLTYWSVFFSFGLCVAFLGPTILDLRCQTQSTLQEITLVFFSQQFFLFLGSTIGGFFSKTL
VSSLSSLAVSTLIISVVFAIIPLCRELLMLAFAMAVSGLAMGTIDTISNLQLVKIYQKDSTVFLQALHFFVGLGALVSPL
IADPFLSDTSCVIGNSSVNTTSLEDLRNKLAGRHVHNVSNVHLHTDGEVVTNVSYAFWIMAIINLPVPIAIFVLVYRERL
FMCGSDPSRRLLDGDVLAIKPRGTSILAEDTGQKETSNSHADLFSCCLLGKAHSFPLSFFGIHVLGGLVLFFSDGIVGSY
TGFVYTYAVAPPMNLPHKTAGYLTCIFWAAITTGRLSAIPLSYRFKPVRLLIVSQVGVIVTVLLLLIFSNSSVFLFIGTC
CLGLFISSIFPCMLALTEDILEYKGCATTVLVTSAGMGEMVLQVLVGSVMHSRGSFSFLLCGMIFGCLGFTFFTFLYFVQ
QSHKSYTEALPGNSPVERHEENGIKTCSAAVLNSWDAPEHKTSLDP