TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q7YUC8 Hydrogenosomal membrane protein Hmp35 (Fragment) - Trichomonas vaginalis.
MEPKTFETVGDEATKLNIKPGLGVCVEENGAKVGVFTDLQLQNPSINSSFNKLPVGTVDCNIAKDGVVGVVLKPDLKQHG
VTVSINPIEKNFTFSVKKECTCTHYEATLGYNSAKKAAEAHLYKQFAVKDSKVNCYLDITGVNNTKPDVNYRIRYDLDKI
GLRTYWDGKDQRFAAFLDLKKAMIGTHFFFNKAVKSVDIYGLKSFKCGKASLIATVLGEQRCRLNFEGCCKDCSYGAKID
YLHGEKPEITAKFGGASKCCSHFSCKYLATVTKKEATTFGIQTSGTFPLHGFGKATVGCALADVKDYKNIGYSFLVELN