TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q7Z205|Q7Z205_CAEEL Cyclic nucleotide-binding domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=cng-3 PE=4 SV=2
MSTHSAQKLPNLHERKRRMSKKPDDDDLIPQHFEYENQYEKWRAANPRIEYDFSVDESGYIYWIWTFFVVCGCLYNIIVL
SVLAFENIRYAYIEKILPINIAFDTVFLFDIILRSMLSFYEDGVLITSFSETWRHYVHSFYFAIDLLAIFPFDYLLIRKT
SAAFCRLNRFLKIYRIANFIAQSYGKLTQVTISLSKIFTACFLLFHVNACVFYIISVNSDTSSWDGVNATFDDDEYLPWP
YTPEKITDAYFVGCDGRTDCYNPYFYYDEAREDHLVELYHFWRTDNRTHIYNFSQFTKEYTLSMYWSAMTMTTLGEQPAP
NTSLQNAFEIVNTLAGLLLFAVIMGSIGDLVANANAVKTFWQTLMDGLKQYMTYRNLNERLQTKVLKYCEYEMAEETIMK
EHEVRDELPAKLYGHVTTSIIGASLVRSPLFRASERSFLNDISQLLEPHYFCPGDVVIEKGQLCSSMFIIVCGQMVEITE
DNEIDHFEGEILGDVNLIWFNNHLNHNRHQHNVISSAFSQIHMLSRDDFFKVLSSYDPKLKRRLCDVAFYLQRQRGELDD
KKRCLSENEDIESNLKRLAIDTLELHDKMTEMEEEFWDFSATAKRKLFESEMVVCDLLNNSQRRSR