TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q82VN7|Q82VN7_NITEU Bacterial extracellular solute-binding protein, family 1 OS=Nitrosomonas europaea GN=NE1029 PE=4 SV=1
MSRSFIFSGHVGRWCSSFLLIVFLFAVPISSQAEEIVVYSSRIEQLIKPLFDAFTKETGITVKFTTDKEGALLTRLLAEG
KRTPADVLITTDAGNLWEAARNGLLKPVTSPVLQANIPENLQDPQGQWFGLTVRARTIVYNTRKVKPEELSTYADLADPK
WKHRLCLRTSKKVYNQSLVAMMIAELGETETERIVKGWVDNLATDPVADDTLALEFVAAGRCDVTLVNTYYYGRLMRENP
TLPLAIFWPNQATTGVHINVSGAGVIQYSKHGAAAVRLLEFLSSEQAQKLFVELNMEYPANPKVEYGELLNSWGSFKGDP
RSIVQAGELQADAVRLMDRAGYR