TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q84568|Q84568_PBCV1 A250R protein OS=Paramecium bursaria Chlorella virus 1 GN=A250R PE=4 SV=1
MLVFSKFLTRTEPFMIHLFILAMFVMIYKFFPGGFENNFSVANPDKKASWIDCIYFGVTTHSTVGFGDILPKTTGAKLCT
IAHIVTVFFIVLTL