TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q84BQ3|Q84BQ3_9PSED Putative periplasmic protein OS=Pseudomonas sp. MIS38 PE=4 SV=1
MVLYTVQAPAEAPKYQTAPVERSDIENTVLATGLLEGVKQVDVGAQVSGQLKSLKVKVGDKVKKGQWLAEIDPLVLQNTL
RQAQVDEENLQAQKRATQAQLKQTKEIYQRYQNLQEDASISRQDFETAQSDYEVQQANLLSLDAQIKSAHIQIDTAKVNL
AYTRIVAPIDGDVVGIVTQEGQTVIANQLAPILLKLADLDTMTIKAQVSEADVIHIAPGQQVYFTILGEDKRYYGKLRGT
EPAPQNFLETPPAGTPKQNTAVFYNALFEVPNPDHRLRISMTAQVRIVLDTAQSVLTVPVAALGPRNADGSFPVRVLDAK
GQAQSRNVQTGINNNVKVQINQGLSEGERVVIGDPLPAVAGA