TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q87WH5|Q87WH5_PSESM Glycine betaine/choline OpuC ABC transporter, ATP-binding protein OS=Pseudomonas syringae pv. tomato GN=opuCA PE=3 SV=1
MIELQNLSKTFQSNGKEVKAVDSVSLTVNEGEICVFLGPSGCGKSTTLKMINRLIMPTSGKVLINGEDTTDLDEVTLRRN
IGYVIQQIGLFPNMTIEENIVVVPKLLGWDKQRCHDRARELMSMIKLEPKQYLHRYPRELSGGQQQRIGVIRALAADAPL
LLMDEPFGAVDPINREMIQNEFFEMQRALNKTVIMVSHDIDEAIKLGDKIAIFRGGKLLQIDHPDTLLAHPADDFVSSFV
GQDSTLKRLLLVKAEDAADNAPSVSPETPVADALEVMDENDRRYIVVTDSENKAMGYVRRRDLHRQQGTCAQFLREFNAT
AAYDEHLRILLSRMYEFNRAWLPVLDAENVFLGEVTQESIAAYLSSGRSRGMKTSIVSPAEQVAS