TCDB is operated by the Saier Lab Bioinformatics Group
>Q88P37|Q88P37_PSEPK Sugar ABC transporter, permease protein - Pseudomonas putida (strain KT2440).
MTTTTAQLRASPLDALQRWLPKLVLAPSMFIVLVGFYGYILWTFVLSFTTSTFLPTYKWAGLAQYARLFDNDRWWVASKN
LLLFGGLFIAISLAIGVLLAVLLDQRIRREGFIRTIYLYPMALSMIVTGTAWKWLLNPGMGLDKLLRDWGWEGFRLDWLI
DPDRVVYCLVIAAVWQASGFIMAMFLAGLRGVDPSIIRAAQMDGASLPRIYWTVVLPSLRPVFFSALMILSHIAIKSFDL
VAAMTAGGPGYSSDLPAMFMYSFTFSRGQMGMGSASAILMLGAILAILVPYLYSELRSKRHA