TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q8CBH5|MFSD6_MOUSE Major facilitator superfamily domain-containing protein 6 OS=Mus musculus GN=Mfsd6 PE=1 SV=1
MAADDKVAILTDDEEEQKRKYVLADPFNGICREPEPPSNETPSSTETSAIPEEEIDWIEKHCVKVNNDLLISKVFYFFFY
SAYGSLYPLLPVYYKQLGMSPSQSGLLVGIRYFIEFCSAPFWGVVADRFRKGKIVLLFSLLCWVLFNLGIGFVKPATLRC
LPKIPPTAHPTNVSHPVTVLPMNSSTVAFFSTPPKLLQKRDVQLSETEPNISDIDLVSTALTLTSEPTRRPQTEAITHPV
TGLILNTSTVTLPPTGNVTRETTIAVVTTTKSLPSDQVTLVYDQQEVEAIFLIILVVVIIGEFFSASSVTIVDTVTLQYL
GKHRDRYGLQRMWGSLGWGLAMLSVGIGIDYTHIDVLIDGKGCKPPEYRNYQIVFIVFGVLMTMALIVATQFRFRYNHFN
NSDGKGKEVEIPQVERDNSTESSEETPTAATHSQAFNFWDLIKLLCSVQYGSVLFVAWFMGFGYGFVFTFLYWHLEDLNG
TTTLFGVCSVLSHVSELTAYFFSHKLIELIGHIRVLYIGLACNTARYIYISYLENAWTVLPMEVLQGVTHAAIWAACISY
LSAAVPPELRTSAQGILQGLHLGLGRGCGAMIGGVLVNYFGAAATFRGIGMACLVILLLFALIQWLAVPDEEEDKTMLAE
RIPVPSSPVPIATIDLVQQQTEDVMPRVEARLPPKKTKHQEEQEDVNKPAWGVSSSPWVTFVYALYQVKELIQLTRESRA
SEIQPLQVTLCWASVASAPLLPPCSSKHMGNRKTGMLAKDISGLRSLCHSVYQVA