TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q8L3C3|Q8L3C3_SERMA N,N'-diacetylchitobiose utilization enzyme IIB of PTS transport system OS=Serratia marcescens GN=chbB PE=4 SV=1
MEKKKIYLFCSAGMSTSLLVSKMKAQAEKYEVPVIIAAYPEALAAEKGVEADLILLGPQIAYTLPEVQKQLPNKPVEVID
PLLYGKVDGLGVLKAAVAAIKKANQ