TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q8R4P5|TMC1_MOUSE Transmembrane channel-like protein 1 OS=Mus musculus GN=Tmc1 PE=1 SV=1
MLQIQVEEKEEDTEESSSEEEEDKLPRRESLRPKRKRTRDVINEDDPEPEPEDEETRKAREKERRRRLRRGAEEEEEIDE
EELERLKALLDENRQMIATVKCKPWKMEKKIEVLKEAKKFVSENEGALGKGKGKKWFAFKMMMAKKWAKFLRDFENFKAA
CVPWENKIKAIESQFGSSVASYFLFLRWMYGVNMVLFVLTFSLIMLPEYLWGLPYGSLPRKTVPRAEEASAANFGVLYDF
NGLAQYSVLFYGYYDNKRTIGWLNFRLPLSYFLVGIMCIGYSFLVVLKAMTKNIGDDGGGDDNTFNFSWKVFCSWDYLIG
NPETADNKFNSITMNFKEAIIEERAAQVEENIHLIRFLRFLANFFVFLTLGASGYLIFWAVKRSQEFAQQDPDTLGWWEK
NEMNMVMSLLGMFCPTLFDLFAELEDYHPLIALKWLLGRIFALLLGNLYVFILALMDEINNKIEEEKLVKANITLWEANM
IKAYNESLSGLSGNTTGAPFFVHPADVPRGPCWETMVGQEFVRLTVSDVLTTYVTILIGDFLRACFVRFCNYCWCWDLEY
GYPSYTEFDISGNVLALIFNQGMIWMGSFFAPSLPGINILRLHTSMYFQCWAVMCCNVPEARVFKASRSNNFYLGMLLLI
LFLSTMPVLYMIVSLPPSFDCGPFSGKNRMFEVIGETLEHDFPSWMAKILRQLSNPGLVIAVILVMVLTIYYLNATAKGQ
KAANLDLKKKMKQQALENKMRNKKMAAARAAAAAGGQ