TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q8R9L8|Y1589_THETN Putative ABC transporter ATP-binding protein TTE1589 OS=Thermoanaerobacter tengcongensis GN=TTE1589 PE=3 SV=1
MTLSDKEIIVKDLTFRYKEQKDRNAIEGINLEVEKGEFIVIMGPSGAGKSTLAQCLNGLIPHFTKGHYSGEVVVRGIKVK
ETPVSKMAKEIGLVFQDFEAQLFSTNTKLEIAFGPENFGVPREEIEEIIRRVLKIVNLEGLEDRPPSTLSGGQKQRLAIG
SVLACMPSILCMDEPTTDLDPIGKIGVFNIARELHEEKELTLIIIEHETEEALNADRIILMEKGKIIKDGKPREVLKEVD
LMEKIGLMPLQIPKYFSQVSNLEKADLPLTYEEGVQKFKELGLQIDEGKYQEILRREDEREKSYGDVIIQAKDVEYVYSN
GTKALDGINLEIREGEFIALLGHNGSGKTTLAKHFNCLLKPTRGSVIVYGKDTKNSNVYEIGNYVGYAFQNPDHQIFADT
VYDEIAFGPRMRGCTEEEVKERVAEALKAVDMEGFEKEDPFALSKGERQRIAVASILAARPKVIILDEPTTGLDYKEQKR
MMELVKRLNESGHTIIMITHTMWIVAEYAHKVAVMRDGKIEMYGKVRDVFKEEERLLELSLKPPSIVSLSNRLGKTFLSV
EEMVSCTKR