TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q8RJU8 Transmembrane protein - Streptomyces olivaceoviridis (Streptomyces corchorusii).
MKTTEPPAPVPAEPGTTVTKTDAPPAPPQKEKKEGTVLNVFSHGILVLWAFMVVLPLLWAVMTSFKDDASIFGSPWSLPD
KLHFDNWSRAWTEAHMGDYFLNTVLVVGGSLIGTLVLGSMAAYVLARFDFPGNRFIYYLFIGGMSFPIMLALVPLFYVVN
NMGLLNTLHGLILVYIAYSLPFTVFFLTAFFRTLPSSVAEAAFVDGASHTRTFFQIMLPMAKPGLISVGIFNFLGQWNQY
MLPTVLNTDPDKRVLTQGLVQLAVSQGYKGDWSGLFAGLVMAMLPVLAAYIIFQRQVVQGLTAGALK