TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q8TJ86|Q8TJ86_METAC Molybdenum ABC transporter, permease protein OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=modB PE=3 SV=1
MMEIFQIIATPLLLTLKISVIATLFVTALGILIAYVLAKREFPGKGLADVMVTMPMVLPPTVTGYILVILLGKNGVIGSI
FSKITGSGILFTWQAAAIAAFVVSLPLMVKTTTAAIGAVDRNVEEASRILGRNEFETALFITLPLAKKGIIAGCVLSFAR
AVGEFGATLMVAGNIPGKTSTMPLSIYGAYQTGNNELANLLVLILVVMSFITIAATSKLGER