TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q8TTV0|Q8TTV0_METAC Molybdenum ABC transporter, solute-binding protein OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=modA PE=4 SV=1
MKKVCALLIIMVLAISLAGSGCTEKGTSTVSETQEKEFSGQQITVCSGAGLIKPMNELVANFENETGADIEVRYGGSAEL
FGILTSKECDVFIPGDFYYTGQAMEKNYVYNESVTNLTLHVPIIAVPEGNPANISKLDDLANPGVKLALGDPKGPAIGRV
SEAICTKEGILPEVENNTIVKTATVNQLLIYIVSGEADATIIWEDMASWSEASGKLETIPIPEEQNKIKTIPTAVSVYTE
DTELAEAFNTYIAGEEAKEVWEKWGFEPCES