TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q8TTV2|Q8TTV2_METAC Molybdenum ABC transporter, ATP-binding protein OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=modC PE=3 SV=1
MSFLEVRDIYLDVGSFELKGIDLRAEKGDYVALIGPSGSGKSLLLETIIGFYGPRQGSVFLEGRDITFFSPDKRQISIVY
QDNMLFPHMDIFENIAYALRKKLKDKKQIELEVTQIAGVLGIRELLHRKPDTLSGGEKQRASLARSLVARPKLLLLDEPF
SALDARTREKLREMLKKAIADYSTTVLHVTHDFEDVWALANRVVVIRKGEVMQVGDPESVFRRPSPDFVAEFLGTNVLKG
TVKALEGKLTVIDAEGMEIYSADPAEPGENVTVSIRPEEIILAGGTVESSARNTLKGRVSGIFKKEHLVVVEVKMGNSEI
KAVVTPTSCEMLGIEPGREMYAVFKASNARIIR