TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q8U1W4|Q8U1W4_PYRFU Putative ABC transporter (ATP-binding protein) OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=PF1090 PE=3 SV=1
MDPWIFVALCFWIATYRDRIRTHWYYIFDNLSFWPKRSLGGSKMKLEIRELSVGYKRPLLEDITLELENGDAVNFYGPNG
IGKTTLLKTIATYLKPLKGEILYNGAPIRKVRGKIFFLPESILVPNKVRARDYLKAVASLYGVNPSMEEVVRALDLVGIS
DENIKFEKCSQGMKRRIQLASALLVNAEIFVLDDPVVAIDEDSKHEILKGIVDTLKKRGIVIISSREKLPYFPINEDVVK
YKPKL