TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q8VM83 Nucleotide binding protein - Rhizobium leguminosarum (biovar viciae).
MTSHLPLLEIKNLSKSYGAVKAVNDVSIHIDRGEIAGLIGPNGSGKSTFFDCSTGLAKPDTGTVVLDGQDITGWSLNRIA
REGRMLRSFQKTVTFRSLDVEENLVIAGQMFTFPSITSTFGLGKMSRQRVGGLRERARDLIKMAGLWDVRHQPAGNLSGG
QQKLIQFASMLMPEPKLILLDEPMAGINPKIIERVVDTIRYANKSLGVSFLVIEHNIDVVTSICQRVIVLDQGAKLVEGL
PGDIIQDQRVREAYLGG