TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q8Y5K1|Q8Y5K1_LISMO Lmo2059 protein OS=Listeria monocytogenes GN=lmo2059 PE=4 SV=1
MDKTKRKMIYETFMLILILLSLALLPYRNNFTFILNWIIWVIFTLDYLVRLYRADNKWHYVKTHPFQLIAIIPFYGGFRA
ARIVSFVHLLSITAMGRRYIVPIYSFFRSNGLNRFLMIFVLLVIIIPVPMVFIEPEINNYPDALWWAIVTATTVGYGDIV
PVTPIGRILASIMMLFGIAFIGMITSTITNFFRAKKPTNSSTQRANKITQLISETPDLTKEEIAVVEQFLTLRKKELADE
NTKSDSE