TCDB is operated by the Saier Lab Bioinformatics Group
>Q8YPM7|Q8YPM7_ANASP Permease protein of amino acid ABC transporter - Anabaena sp. (strain PCC 7120).
MTKLTWLRKNLFSTWYNSLLTVICSALSLWLVQGIIVWATTKAQWAVIQVNLRLFLVGRFPQTEYWRVWIVLAIASTLGA
VTAGIFFNQQKLTWRKVGLFAFIVGLLLILFTLDLSSRLWLLLTAVLLIPGFLLGSRLTNLVAPWLSLIWLLSFPIILWL
IGGGFGLRPVSSNLWNGLLLTLLMAAISIVLSFPIGVLLALGRTSNLPVVRWFSILYIEIVRGVPLIGILFLAQVMLPLF
FAADVRLDRVLRAIAGLVLFSAAYMAENVRGGLQAVSRGQVEAAKALGLNTFFVVLLIVLPQALRAVIPALVGQFIGLFK
DTSLLSLVGLVELTGIARSILAQPQFIGRYAEVYLFIGLIYWLFCYSMSLASRRLERQLNN