TCDB is operated by the Saier Lab Bioinformatics Group
>Q8YSA2|Q8YSA2_ANASP Glutamine-binding periplasmic protein of glutamine ABC transporter - Anabaena sp. (strain PCC 7120).
MSKRVFGRWCLVLSLICLFLTGCSGNLSQGKTLRIATEPAFPPFEFTAQGGNLQGFSIDLMNAIASAANLKVNFQSLPFD
GIIPALQSRTVDAAISSITITAERAETVAFSRPYFKAGLAIAIRSSNEDITGFDSLKNKKIAVQIGTTGAGKAKSIPGAQ
IRSFDSAPLALQELLNNNVDAVINDAPVTLYAINTGNLQGIKVVEKLLTEEYYGIATAQNSPYLALINDGLNRVLADGSY
SQIYQKWFKVEPPSLPDKSLYENQTNTHKSGSINLILQFLPTLLQGALVTIQLTILSTVLGLICGTLIALTRLSQFTPAR
LFARAYVDFFRGTPLLVQIFMIYFGIPALAQQLGFTFNFDRWVAGVIALSVNAAAYIAEIVRAGIQSIETGQTEAAKSLG
LNPWLTMRLVIFPQAFRRMLPPLGNEFISLLKDTSLVAVIGFEELFRKGQLIVADNYRAFEIYAAVAIVYLCLTLLASQV
LSRLEMWMNPTMKAQQRKAKR