TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q8YT15|Q8YT15_ANASP ATP-binding protein of branched-chain amino acid ABC transporter - Anabaena sp. (strain PCC 7120)
MSGSAQNFTPLLEVENVHAGYIKDVDILQGVNFRVESGELVTVIGPNGAGKSTLAKTIFGLLTPHTGKITFKGKNIAGLK
SNQIVRLGMCYVPQIANVFPSLSVEENLEMGAFIRNDSLQPLKDKIFAMFPRLSDRRRQRAGTLSGGERQMLAMGKALML
EPSLLVLDEPSAALSPILVTQVFEQVKQINQEGTAIILVEQNARKALEMADRGYVLESGRDAISGPGQELLTDPKVAELY
LGAGKGH