TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q90X34|Q90X34_DANRE Na+/K+ ATPase alpha2 subunit OS=Danio rerio GN=atp1a2a PE=2 SV=1
MGKGYGHESSPEAAPTGGKRKKKDKDLDELKKEVSLDDHKLTLDELSTRYGVDLARGLTHKRAMEILARDGPNALTPPPT
TPEWVKFCKQLFGGFSILLWIGAILCFLAYSIQAATEDEPVNDNLYLGVVLSAVVIITGCFSYYQEAKSSRIMDSFKNMV
PQQALVIRDGEKLQINAEEVVQGDLVEIKGGDRVPADLRIISSSGCKVDNSSLTGESEPQTRSPEFTHENPLETRNISFF
STNCVEGTAHGIVIATGDHTVMGRIATLASGLEVGQTPINMEIEHFIHIITGVAIFLGMSFFILSIILGYTWLEAVIFLI
GIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTED
QSGCDFDKSSPTWFSLSRVGGLCNRAVFKAGQEEIPIRTRDTAGDASESALLKCVEILSGNVETLRENNRKVAEIPFNST
NKYQLSIHELEDSPTGHLLVMKGAPERILDRCSTIMINGEEFPIDDDWMDAFQGAYMELGGLGERVLGFCHLFLSPSQFP
RGFEFDCDDVNFPVNQLCFLGLISMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAE
RLNIPLSQVNPREAKACVVHGSDLKDMSSEYLDDILRNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALK
KADIGVAMGITGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLLFIIASVPLPLGTVT
ILCIDLGTDMVPAISLAYESAESDIMKRQPRNPKTDKLVNERLISMAYGQIGMIQALGGFFTYFVIMAENGFLPQTLLGI
RLDWDDRTVNDLEDGYGQQWTYEQRKIIEFTCHTSFFVSIVVVQWADLIICKTRRNSVFQQGMKNRILIFGLFAETALAA
FLSYCPGMDVALRMYPLKIMWWFCAFPYSLLIFVYDEIRKFILRRNPGGWVEIETYY