TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q92TN3|Q92TN3_RHIME ABC transporter, ATP-binding protein OS=Rhizobium meliloti (strain 1021) GN=RB1477 PE=3 SV=1
MSAIFEVRNLKRSFGGLAVTNDVSLSMAPGDRVALIGPNGAGKTTFVNLVTGNLKPDAGEVRIGGETVTNVDAIGRVRRG
LVRSFQVTRLFQDMTPAEHVALAVLQRDGRAGRMFGNFLAMPGVMAEAGSLLGKLGLRDLAHRPVREIAYGQQRLLEIAV
ALALKPRVLLLDEPAAGVPQSDTGRIEQALADLPDDLAVLMIEHDMDLVFRFAKRVIVLAAGTVIFDGSPADVTKDPRVR
EAYLGSYADAGSAA