TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q92TN4|Q92TN4_RHIME Putative branched-chain amino acid uptake ABC transporter ATP-binding protein OS=Rhizobium meliloti (strain 1021) GN=RB1476 PE=4 SV=1
MPAAPLEVDNLSAGYGPTRVLEGISFSVPAGARLAVLGRNGMGKTTLLATLAGQTRRYEGRIRIGDANVTALPSASRALK
GLGFVPQARCVFPSLTVEENLFVGLKGRPKTALSEAYEMFPRLYERRRNLGSQLSGGEQQMLSTARSILGRPSVLLLDEP
LEGLAPVICEELMKAFAELAKTGGMTILLVEQRIQSALDFADRVIILERGRLAWSGTPEALAKEHATVERLLGVGGLH