TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q930W3|Q930W3_RHIME Putative uncharacterized protein OS=Rhizobium meliloti (strain 1021) GN=RA0081 PE=4 SV=2
MIVACLFVLLATGMPIAFALGLAAFAALYMQSGAGIFYVLGDTMFSGIANLAYVSIPMFVLMGAAVASSPAGSDLYTSLD
RWLNRIPGGLILSNIGACAIFSGMTGSSPATCAAIGKMGIPEMMRRGYPASVASGSIAAGGTLGILIPPSVTLIVYGIAT
ETSIGRLFMAGILPGILLTIMFMTWAVIDCKRKGYEFEARLVRYSMKERLAVLPRILPFLLIIAGTLYVLYGGIATPSEA
AGAGAFLTLAVVIVAYRLFRFRPVAGIFGSAMKESVMIMMIMAAAELFAFALSSLFITQTVAAAIADMEVNRWVLMAVIN
VFLLICGMFLPPVAVIVMTSPMLFPIVTQAGFDPYWFAIVLTINMEVGLITPPIGLNLFVINAIAPQIPTKDILWGSLPY
VLVMFLAIILLCVFPDVATWLPNQMLGDRPMNTTSFFSDMLQSIAERGRRFLSLGPARNGDVNPVGTMEALCDTLLSSRG
EASGMALAKNILDRWQGFDQDKRRDFMLALLSRFGPDIERLERAIDAYRADPTPKALLEMSMAAEPRRQELIRRLNLAPN
GIATLVRMRADLLELKAQNPDLEAVDTDFAHLFGSWFNRGFLVLRPISWSTPADILEKIIRYEAVHHIGGWDELRRRLAP
EDRRCFAFFHPQLVDDPLIFVEVALTREMPPNIADLLKEDRAPIRATDATTAVFYSISNCQEGLRGISFGNFLIKQVVED
LRRDLPRLDTFVTLSPVPGFADWLSRERQAETSNALSAADRSRLAALDEPDWADQPEIAAAIQPSLTAAAAWYFLRARNR
NGKTVDPVARFHLGNGARLERINFLGDRSERAMRQAHGLMVNYLYKLDDIETNHEAFATRGEVVAAPAIRRLIPADRSSR
SLVPGPNVFPPGVRSADAPGRKGDKEFTS