TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q97VF8 ABC transporter, permease protein - Sulfolobus solfataricus.
MNYKWLIRRLASVIIAIFVTIVISWALLEFSPYSPANYIMQFINPQDFAQKPELYASLIDYLNTLRPHGNPLINAVNYIW
NTLHGNLGFSIISNVPVAELIAVALPWTLFIVVTSILISFFLGIRLGQKLGYLRGTKTDSVATVSLSILRSVPIYIYAVL
LIYILAFIYHIFPTGGAYSIHVTPGFNLPFIASVLYHAFLPILTLTIVNLVGWILQMRANTIYVLGEDFVNFAEISGVKK
DIIEKKYIGKNAILPLYTSLIISIGFSFSGSVFVEQTFSYPGVGNLLINSITSNDYPTEMGVFIIIIVAVIVGNLIADLT
YSFLDPRAKVGEE