TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q986E2|Q986E2_RHILO Bacteroid development protein; BacA OS=Rhizobium loti (strain MAFF303099) GN=mlr7400 PE=4 SV=1
MFVSFFPQPKLFFSSAAIWSLAAILFWFFGGEQLGAVFGLPAAAADAPPIIGIAVLVSKPFLWFYIYFVACVAIFYAFWS
WYSPHPWQRWSILMTAVILFFIYFNVQVSVAVNAWYGPFFDYVQGLMSGTGKSTNGEFYTGLADFSWLALVGMNVQVVNA
FIVSHWIFRWRTAMNNYFIENWARLRHIEGASQRIQEDTMRFSQIMEDLGSSFVQSIMTLIAFLPVMIQLQAHISELPII
GAIPQPLVVAALAWCLFGTISVMIAGLKLPGLQFRNQRVEAAYRKELVYGEDHVDRAQPATTAELFANVRHNYFRLYFHY
IYFNVVRYTYLQADNIFSLLILGPSLVAHKITFGALNQISNAFGKVTGSLQFLLTSWSTIVELQSVHKRLRAFEATLLGE
PLPDIDQRYLARQGAEDPA