TCDB is operated by the Saier Lab Bioinformatics Group
>gnl|TC-DB|Q9DCP2 2.A.18.6.2 Sodium-coupled neutral amino acid transporter 3
MEIPRQTEMVELVPNGKHLEGLLPVGVPTTDTQRTEDTQHCGEGKGFLQKSPSKEPHFTDFEGKTSFGMSVFNLSNAIMG
SGILGLAYAMANTGIILFLFLLTAVALLSSYSIHLLLKSSGIVGIRAYEQLGYRAFGTPGKLAAALAITLQNIGAMSSYL
YIIKSELPLVIQTFLNLEKPASVWYMDGNYLVILVSVTIILPLALMRQLGYLGYSSGFSLSCMVFFLIAVIYKKFQVPCP
LAHNLANATGNFSHMVVAEEKAQLQGEPDTAAEAFCTPSYFTLNSQTAYTIPIMAFAFVCHPEVLPIYTELKDPSKRKMQ
HISNLSIAVMYVMYFLAALFGYLTFYDGVESELLHTYSKVDPFDVLILCVRVAVLIAVTLTVPIVLFPVRRAIQQMLFQN
QEFSWLRHVLIATGLLTCINLLVIFAPNILGIFGIIGATSAPCLIFIFPAIFYFRIMPTDKEPARSTPKILALCFAAVGF
LLMTMSLSFIIIDWVSGTSQHGGNH