TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9F9B1 FRCC (Putative permease ABC transporter protein) - Rhizobium meliloti (Sinorhizobium meliloti).
MGETNTAAQPSQEFEKVLADSSTDVASFDAHDKTLLQKLQHFLHSSPAAVPLIVLVLSLIAFGVILGGKFFSAFTMTLIL
QQVAIVGIVGAAQTLVILTAGIDLSVGAIMVLSSVIMGQFTFRYGFPPALSVICGLGVGALCGYINGTLVARMKLPPFIV
TLGMWQIVLASNFLYSANETIRAQDISANASILQFFGQNFRIGNAVFTYGVVVMVLLVCLLWYVLNRTAWGRYVYAVGDD
PEAAKLAGVNVTRMLISIYTLSGLICALAGWALIGRIGSVSPTAGQFANIESITAVVIGGISLFGGRGSIMGMLFGALIV
GVFSLGLRLMGTDPQWTYLLIGLLIIIAVAIDQWIRKVAA