TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9HS33|Q9HS33_HALSA Multidrug resistance protein homolog - Halobacterium salinarium (Halobacterium halobium)
MGLLDTDRRVLTLALARMADALGNSFLIVLLPAYIGEGYVAVDSLTGPLSVAGVSVLTVTPALLIGIVLSTFGFLNSFLQ
PFTGRLSDRTGVRKPFILGGLVLLALASGAYAFVSDYRLLLVLRALQGIGAALTVPATVALVSELGTTETRGSNFGVFNT
FRLIGFGFGPIIAGVVLEVFSFNAAFGVAAAGALTSFVLVELTVDEPDTDGADAGDDLSIAVRGDDAVLDPVFALGIATV
AMGICIAMFATLEAKINGKLDQSSILFGAEFGAVTLANVMFQVPIGTASDTYGRRPFIIAGFIILIPATIAQGYAPTPAT
MILARFVQGIAVAAVFAPSLAVAGDLAGAGESGSTLAVLTMGFGLGTAIGPLASGFLAAYGLATPFLIGGVLAALALAVV
YTQVYETVPDATAVSASTGD