TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9HTI6|Q9HTI6_PSEAE Putative uncharacterized protein OS=Pseudomonas aeruginosa GN=PA5378 PE=4 SV=1
MKGCKSWLLAVSLCAPLAAQAAEPESCASVRFADVGWTDITVTTAVTRQVLESLGYKTKVNLLSVPVTYRSLANNDLDVF
LGNWMPTMTNDIKQYAEKGTVETLRANLEGAKYTLAVPQYVYDGGLRSFADIAKFSDKLGNKIYGIEPGNDGNRVAQSMI
DKNAFELGKFKLVESSEAGMLSQVQRAIRRNQWVVFLGWEPHPMNTRFQMKYLEGGDDFFGPNYGGATIYTNVRKGYAQE
CANVGQLLKNLSFTLEMENKLMDAVLNENKKPEEAAKAWLKDHPEQLDAWLAGVTTRDGQPAAAAAKLAFAK