TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9KCR8 Hypothetical protein BH1501 - Bacillus halodurans.
MKMEARQKQNSFTSKMQKIVNHRAFTFTVIALILFNALIVGIETYPRIYADHKWLFYRIDLVLLWIFTIEIAMRFLASNP
KSAFFRSSWNWFDFLIVAAGHIFAGAQFVTVLRILRVLRVLRAISVVPSLRRLVDALVMTIPALGNILILMSIFFYIFAV
IGTMLFQHVSPEYFGNLQLSLLTLFQVVTLESWASGVMRPIFAEVPWSWLYFVSFVLIGTFIIFNLFIGVIVNNVEKAEL
TDNEEDGEADGLKQEISALRKDVAELKSLLKQSK