TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9KR64|Q9KR64_VIBCH C4-dicarboxylate-binding periplasmic protein OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=VC_1779 PE=4 SV=1
MKTINKITIAILTLSAAASVNAATTLKMGMQASVGSVEYNSAKMLADTLEEMSQGEIKLALYPSAQLGDDRAMLQQLTLG
DLDITYAEFGRMGLWIPRAEAVMLPYVAKDFDHLRRMFESDFGQGVRDEMLQKFNWRALDTWYNGTRETTSNRPLNSIED
FKGLKLRVPNAKQNLNYAKLSGASPTPMSFSEVYLALQTNAVDGQENPLPTIKTMKFYEVQKNLAMTHHIVNDQMVIISE
STWQKLSDTDKDIIQKAVQKVGDAHTQTVKTQEAELVSFFKSEGINVTYPDLEPFREAMQPLYKEFDSNIGQPIVSKLAA
M