TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9L1J2|Q9L1J2_STRCO Putative amino acid transporter OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO2724 PE=4 SV=1
MTDTLRPAETAAVPPDTPAPQAPSESRTLKRSIGVVGGTLLTLSCVTPASTLFVVVPDLFGSLGTATALTIAVGSLLCVA
VAFCYSELGTLVPSAGGEYAMVSTMAGRLAGWLVFVLSLLVVMIVPPVIAMGTADYLEPVLHLDPSLAGAGVMLLATLAG
LLDLRANAWITGVFLVLEVIAAAVVAVLGFAHAERGPGSLVSMEVGGTGGGADPVTAMLVVSGLAIALFITQGFSTAVYL
SEELENPRRNVARTVLATLAISTVIILVPVVAITFGASDLAELTGGDISAMVTAWSNSAVGTFVSLCVALAIVNAGIVMV
IQNSRVLFASARDKAWPAPVNGLLGRLGRFGSPWVATLAVGVPGAALCYVDLDTLYGVTGVSVTAMYLLVAVAALLSRRG
AHRHAHAWRMPLWPVVPVLLIAVLAYVLTQQEASHLLLTGSIAAVATLYWALYLRPRLDTRWLVTVPQDVREPAGP