TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9RMB3|Q9RMB3_ACEWO ATP synthase subunit delta OS=Acetobacterium woodii GN=atpH PE=3 SV=1
MSLVASKYARALFDVAVDKDQLDEIFSDFKTATDLFSSEKKFMDLMLTPSLNTGEKKGILMRSLESLSNQYVKNYLMILM
DKNRFEDIFDIYEAFRKLCNEHKNLVEARVLTVIPLDETLRIALEENLAKRFNKKVILENEIDKSILGGAVVYVGDQIID
GSIKNQLSQMKKQVNNLRLH