TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9U7C3|Q9U7C3_9TRYP Peroxisome targeting signal 1 receptor PEX5 OS=Trypanosoma brucei PE=1 SV=1
MDCGAGFALGQQLAKDALHMQGGVRPGTTGNVEQDALMTGMMVPPTGPMEDWAQHFAAHQHHHQQHQQMMMQRQHNDALM
IQQQHRDMEEAFRASARAGAPQQANAGPLMMPPGPMMMAGGMAPMMHAGGFMMGGMPQMMPCAPMGMNMGMAPVATMSPA
TTNTVSGAREGATAVSSAAPGVVDLGGDSAWAEKLHQAEWGQDYKDVEVHTVEGSTAQTVEEHAKTSKFYEFMDKIRKKE
LLVDEDSGEVVQGPGPDPDVEADTEYLARLAAMEGINVPPSVMDHMQGQDGVQRGTDEDMEGMMGDDVYDPSADVEQWAQ
EYAQMQAMQERLQNNTDYPFEANNPYMYHENPMEEGLSMLKLANLAEAALAFEAVCQKEPEREEAWRSLGLTQAENEKDG
LAIIALNHARMLDPKDIAVHAALAVSHTNEHNANAALASLRAWLLSQPQYEQLGSVNLQADVDIDDLNVQSEDFFFAAPN
EYRECRTLLHAALEMNPNDAQLHASLGVLYNLSNNYDSAAANLRRAVELRPDDAQLWNKLGATLANGNRPQEALDAYNRA
LDINPGYVRVMYNMAVSYSNMSQYDLAAKQLVRAIYMQVGGTTPTGEASREATRSMWDFFRMLLNVMNRPDLVELTYAQN
VEPFAKEFGLQSMLL