TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9X0S9|Q9X0S9_THEMA Maltose ABC transporter, permease protein - Thermotoga maritima.
MVQRRGNIFTHIFLIFIIAVILFPVVWVVTTSLRRDEAAFSSKLFTSRLTLQHYRDLVAPEKNLPFLVQDLQAMISKVKP
YDTWSEEELKDAVESSIEKVKAYLSETETRLNDAVNSFEKVDAFLNDHSEEIKNRTIEEMRELLSSIQIPDLSDSVENRA
ALYLVLSKERYNSTAHKALKELLERFTGVDTGTRDGYEKAIESLKESYEKLADGYDGLIKETQRELNAVKEEMSSLRQQY
SALQDNVMEANLVIEKDIIPELERIKISLSELNNLREQIRQTALRSPFPVNDEEFSRNVSEAVQMLNKFLNEMGSFAEYD
SLKNSLVELKKELTKLSEGSEDLRNRLLFSDLVKIYEELHPRLIRILKETAETIASIKDRIAVLNVLNERLKDLEIQEKD
LTAKISEYQQKISEVQQKLLEPQRTLNLIVFRYELEKTISSLERVKAFKKTDLLRYSSALKTLRNFMNSYWKKDELYSRI
SRAVKEMRWIEEYRDFASKFDVFPENLKAILEEMHTSLSDLERSYGDFISLSSQGVYVSSSVLSRMYDIVKMDFVNKVRA
NMSVASRRAGNLIDLVPFSEVKKDLRNIDRELFRIDQIWKQKTKHYFWLWVLNSVIVSLIVAFITTTVCAIAAYPFSRMR
FFGRRYGIMALLLIQMFPGVIFMIAIYDLLNFMGKYIPFIGIDTLGGLIFAYLTNIAYNMYLIKGFYDTIPTSLEEAAIV
DGATRFQSFYKIIIPLARPILTVVFLLVFIGTFNEYVVARIILQNVRHYTYALGLQAFATGPYETEWGLFTAAALLGMTP
MVILFLSLQRYLVSGLTRGAVKE