TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9X2F5|Q9X2F5_THEMA Maltose ABC transporter, permease protein - Thermotoga maritima.
MMVRKKNRWLTHVLLTLLVVVVLFPIVWVVSTSFRRDEAAFSPKLFSSRLTLQHYKDLVAPEKNLPVLIQEMQSLVSRVE
PFDNVSREKADRLIEDRIRRFENYLAETKKLLEDVNARNSKIEETLSQRFSDVLSYTKDVLEEAKKLTQEQMDKTPLPDS
QRIAVALYEKLKGKNFRSAEFQALKDVIEKVVGYSVENQDTLNDALSELGLVYEKEVGTLMKEIEKLEGEIEILQREIAV
LEKQKETLEKEILEKQKVLEVLKPDIDSVSEVLVKLKEMVHSVRNSKVETAFPYEDSRLKSSLEKLLSELNTLYDKISAF
SDLSDLSEKIFAMKSSLEEINNVVSEDGDISKKALYGSFVQSFEETVPIIEGIVEKVSDGIDDFVQKIKDLKDIENEIMV
LTAKLDGLEKSLNNVRSSLSEKEKEISSAKMYLDLKIFNHQIQSRIDSLESMKSFNNAAQIKLLSIYKTLKNFVSSYVSE
YGGDDFIGKIRKLAAKLSWIEDYRDLNRRIETGYKNAVEIVEKAQNILDDFKGSYSNLLDLSFKGLYVSSEHLEMLYDLV
KMNFVQEVLTNTAVASRKAGTLMDTIPLKELKSDLKKIDGDLYRLAQIWEQKTKHYFLRWVMNSVIVAGLVSLITTAVCA
LAAYPFSRMRFWGRQYGIMALLLIQMFPAIMYMVAIYGLLKLIGQFLPFLGLDSLGGLIFAYLGNIAYNMYLIKGFYDTI
PSSLEEAAMIDGATRFQTFYKIVVPLALPILTVIVILTFIGTFNEFVLARIILQDVKNYTYALGLWTFSTGAYETEWGLF
TAAALLGMTPMVILFLSLQKYIVGGLTKGSVKG