TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9XI73|Q9XI73_ARATH F7A19.23 protein OS=Arabidopsis thaliana GN=F7A19.23 PE=2 SV=1
MSSFTTTNTPPPYLLRKIYHRRVNQPFSVVCCTGEPQQDIFTRRRTLTSLITFTVIGGATSSALAQEKWGTRSFIKEKYF
MPGLSPEDAAARIKQTAEGLRDMREMLDHMSWRYVIFYIRLKQAYLSQDLTNAMNILPESRRNDYVQAANELVENMSELD
FYVRTPKVYESYLYYEKTLKSIDNVVEFLA