TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q9XIB6|PLRX2_ARATH Pollen-specific leucine-rich repeat extensin-like protein 2 OS=Arabidopsis thaliana GN=PEX2 PE=1 SV=1
MERPFGCFFILLLISYTVVATFDDEPSFPENADLTKDLEQKCFSINKVDPNLKFENDRLKRAYIALQAWKKAIYSDPFKT
TANWVGSDVCSYNGVYCAPALDDDSLTVVAGVDLNHADIAGHLPPELGLMTDLALFHINSNRFCGIIPKSLSKLALMYEF
DVSNNRFVGQFPEVSLSWPSLKFLDLRYNEFEGSLPSEIFDKDLDAIFLNNNRFESVIPGTIGKSKASVVTFANNKFSGC
IPKSIGNMKNLNEIVFTGNNLTGCFPNEIGLLNNVTVFDASKNGFVGSLPSTLSGLASVEQLDLSHNKLTGFVVDKFCKL
PNLDSFKFSYNFFNGEAESCVPGRNNGKQFDDTNNCLQNRPSQKPAKQCLPVVSRPVDCSKDKCSGGSNGGSSPSPNPPR
TSEPKPSKPEPVMPKPSDSSKPETPKTPEQPSPKPQPPKHESPKPEEPENKHELPKQKESPKPQPSKPEDSPKPEQPKPE
ESPKPEQPQIPEPTKPVSPPNEAQGPTPDDPYDASPVKNRRSPPPPKVEDTRVPPPQPPMPSPSPPSPIYSPPPPVHSPP
PPVYSSPPPPHVYSPPPPVASPPPPSPPPPVHSPPPPPVFSPPPPVFSPPPPSPVYSPPPPSHSPPPPVYSPPPPTFSPP
PTHNTNQPPMGAPTPTQAPTPSSETTQVPTPSSESDQSQILSPVQAPTPVQSSTPSSEPTQVPTPSSSESYQAPNLSPVQ
APTPVQAPTTSSETSQVPTPSSESNQSPSQAPTPILEPVHAPTPNSKPVQSPTPSSEPVSSPEQSEEVEAPEPTPVNPSS
VPSSSPSTDTSIPPPENNDDDDDGDFVLPPHIGFQYASPPPPMFQGY