TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q9XIL9|PLRX3_ARATH Pollen-specific leucine-rich repeat extensin-like protein 3 OS=Arabidopsis thaliana GN=PEX3 PE=2 SV=1
MPHIYKQPLGIFQGFVPTLTDAEVSFIAQRQLLTLPENGELPDDIEYEVDLKVTFANHRLKRAYIALQAWKKAVYSDPFN
TTGNWHGPHVCGYTGVFCAPALDDPDVAVVAGVDLNGADIAGHLPAELGLMTDVAMFHLNSNRFCGIIPKSFEKLSLMHE
FDVSNNRFVGPFPSVVLSWPAVKFIDVRYNDFEGQVPPELFKKDLDAIFLNNNRFTSTIPDSLGESSASVVTFAHNKFSG
CIPRSIGNMKNLNEIIFKDNSLGGCFPSEIGKLANVNVFDASMNSFTGVLPPSFVGLTSMEEFDISGNKLTGFIPENICK
LPKLVNLTYAYNYFNGQGDSCVPGSQKQIALDDTRNCLPDRPKQRSAKECAVVISRPVDCSKDKCAGGSSQATPSKSPSP
VPTRPVHKPQPPKESPQPNDPYNQSPVKFRRSPPPPQQPHHHVVHSPPPASSPPTSPPVHSTPSPVHKPQPPKESPQPND
PYDQSPVKFRRSPPPPPVHSPPPPSPIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPP
PPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPPPVFSPPPPVHSPP
PPVYSPPPPVYSPPPPPVKSPPPPPVYSPPLLPPKMSSPPTQTPVNSPPPRTPSQTVEAPPPSEEFIIPPFIGHQYASPP
PPMFQGY