TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9ZAA8 GLUTACONYL-COA DECARBOXYLASE DELTA SUBUNIT (EC 4.1.1.70) - Acidaminococcus fermentans.
MTDNPWLIMMINMTIVFGVLIVLGILMVLIHAVDPTKKVQGKKKPVVAKPAPSAAASKRQEEEKVAAMAAVLALVQDEDD
MIAAALSAAIAEHKRKMEPMNLPHHSF