TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9ZBX6|Q9ZBX6_STRCO Putative ABC transporter ATP-binding protein OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO3956 PE=4 SV=1
MIATESLSKRFPRVTALDRLSVDVGPGVTGLVGANGAGKSTLIKILLGLSPATEGRAEVLGLDVATKGADIRERVGYMPE
HDCLPPDVSATEFVVHMARMSGLPPTAARERTADTLRHVGLYEERYRPIGGYSTGMKQRVKLAQALVHDPQLVFLDEPTN
GLDPVGRDEMLGLIRRIHTDFGISVLVTSHLLGELERTCDHVVVVDGGKLLRSSSTTDFTQTTTTLAIEVTDTDEHPDGT
RAVREALDARGVSVQDGSGLPGAGRVLLLTSAGEETYDLVRDVIADLGLGLVRMEQRRHHISEVFTDSDAARKEAVGHGS