TCDB is operated by the Saier Lab Bioinformatics Group
>Q9ZK21|RL1_HELPJ 50S ribosomal protein L1 - Helicobacter pylori J99 (Campylobacter pylori J99).
MAKKVFKRLEKLFSKIQNDKVYGVEHGVEVVKSLASAKFDETVEVALRLGVDPRHADQMVRGAVVLLHGTGKKVRVAVFA
KDIKQDEAKNAGADVVGGDDLAEEIKNGRIDFDMVIATPDMMAVVGKVGRILGPKGLMPNPKTGTVTMDIAKAVTNAKSG
QVNFRVDKKGNVHAPIGKASFPEEKIKENMLELVKTINRLKPSSAKGKYIRNAALSLTMSPSVNLDAQELMDIK