TCDB is operated by the Saier Lab Bioinformatics Group
>RDH20175.1 natural resistance-associated macrophage protein [Aspergillus niger ATCC 13496]
MNCPSRTDDTLEHPGWNQNPPALNADITTRSDFNGIANSKVHRRHAGGMGGAAAEGIAAMDHRPNSLDGNEPEMEKKTPG
EVIAAAPGDQSPRTSSESPRRPFKKSTISFFLRLAQSIKKFGRFVGPGFLIAVAYIDPGNYSTDVAAGAEFRYALLFIVL
VSNLFAIFLQSLCIKLGTVTGLNLAENCREHLPKWLNYILYVFAEAAIVATDIAEVVGSAISLNLLLKIPLVAGCAITLA
DVLFILIFYRPNGAMWGLRLFEFFVMLLVLGVVICFCIQLALIKEQSVGAVFRGYLPSSAIVQSNGLYQSCGILGATVMP
HSMFLGSGVVQSRLKEFDVTQGYVDPSVCLGSTNGEVEYRPSIQAIRGCLKYSVIELTLSLFTFALFVNSAILIVAGASL
YGTSGADEADLWGIYNLLSSSIAPAAGLIFALALLLSGISAGIVCTMAGQMVSEGMLNWSIRPWLRRLVTRSISIIPSII
IAAAVGKEGLNKTLNASQVVLSVILPFVTAPLVYFTCRNRYMTVPTDRNFTGEDSSADGVKMRNNWLVTAIAVIVWVIIA
VMNVALLILIGLGKA