TCDB is operated by the Saier Lab Bioinformatics Group
>RME73333.1 UPF0104 family protein [Chloroflexi bacterium]
MGLVPAGNFTKRMKHYRRLLFIAALSLLMVLALVKLGRVEISLNTLKRVHAGWYGLVIVSFYASVAARGWRWRRILHEMG
HPVGLVYASALLTAGLFLSAILPARAGDLGRLAMLKQDHDVPIAVGLASIAAERVLDVFALLVLAGVGGWLALSGHLPPE
VVQLLTGVTSLMAVGLVGLVAVPGLEQRLVDLPGLGRLPLRVQSLYRRGLDFGLTMVNSIRLLTRRPAALAVIVGQSFFI
WLWDGVIIYFILLSLNIVRPFSISLFTAMTGALAAAIPLTPGALGQYDAALISLLALFGLPTADGSLTVLLLRVVQLWTF
IPVSGLVTYVFGFSRALSLGEGRDV